SCOPe 2.02: Domain d2iv0b_: 2iv0 B:

Lineage for d2iv0b_ (2iv0 B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (15 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [187335] (1 PDB entry)

8. Domain d2iv0b_: 2iv0 B: [165707]
   automated match to d1ai2a_
   complexed with cl, zn

Details for d2iv0b_

PDB Entry: 2iv0, 2.5 Å

PDB Description: thermal stability of isocitrate dehydrogenase from archaeoglobus fulgidus studied by crystal structure analysis and engineering of chimers

PDB Compounds: (B:) isocitrate dehydrogenase

SCOPe Domain Sequences for d2iv0b_:

Sequence; same for both SEQRES and ATOM records:

>d2iv0b_ c.77.1.1 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mqyekvkppengekiryengklivpdnpiipyfegdgigkdvvpaairvldaaadkigke
vvwfqvyagedayklygnylpddtlnaikefrvalkgplttpvgggyrslnvtirqvldl
yanvrpvyylkgvpspikhpekvnfvifrentedvyagiewprgseealklirflknefg
vtiredsgigikpisefatkrlvrmairyaiennrksvtlvhkgnimkytegafrdwgye
vakqefgeycitedelwdkyggkqpegkivvkdriadnmfqqiltrtdeydvialpnlng
dylsdaaaaligglgiapgsnigdgigvfepvhgsapkyagqnkvnptaeiltgalmfey
igwkdasemikkavemtissgivtydihrhmggtkvgtrefaeavvenlqsl

Timeline for d2iv0b_:

• d2iv0b_ first appeared in SCOPe 2.01
  
• d2iv0b_ appears in SCOPe 2.03
  
• d2iv0b_ appears in the current release, SCOPe 2.08