Lineage for d2iuxa_ (2iux A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212133Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 1212178Protein automated matches [190340] (3 species)
    not a true protein
  7. 1212193Species Human (Homo sapiens) [TaxId:9606] [187164] (3 PDB entries)
  8. 1212196Domain d2iuxa_: 2iux A: [165705]
    automated match to d1o86a_
    complexed with act, cl, nag, nxa, zn; mutant

Details for d2iuxa_

PDB Entry: 2iux (more details), 2.8 Å

PDB Description: human tace mutant g1234
PDB Compounds: (A:) angiotensin-converting enzyme

SCOPe Domain Sequences for d2iuxa_:

Sequence, based on SEQRES records: (download)

>d2iuxa_ d.92.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip
fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp
yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq
litgqpqmsasamlsyfkplldwlrtenelhgeklgwp

Sequence, based on observed residues (ATOM records): (download)

>d2iuxa_ d.92.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwqks
mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
alreganpgfheaigdvlalsvstpkhlhslnllssggsdehdinflmkmaldkiafipf
sylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpy
iryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamql
itgqpqmsasamlsyfkplldwlrtenelhgeklgwp

SCOPe Domain Coordinates for d2iuxa_:

Click to download the PDB-style file with coordinates for d2iuxa_.
(The format of our PDB-style files is described here.)

Timeline for d2iuxa_: