Lineage for d2iu2a_ (2iu2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990639Species Human (Homo sapiens) [TaxId:9606] [187027] (25 PDB entries)
  8. 1990648Domain d2iu2a_: 2iu2 A: [165691]
    automated match to d1fhaa_
    complexed with gol, zn; mutant

Details for d2iu2a_

PDB Entry: 2iu2 (more details), 1.8 Å

PDB Description: recombinant human h ferritin, k86q, e27d and e107d mutant, soaked with zn ions
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d2iu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iu2a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinldlyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhldknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d2iu2a_:

Click to download the PDB-style file with coordinates for d2iu2a_.
(The format of our PDB-style files is described here.)

Timeline for d2iu2a_: