Lineage for d2itna_ (2itn A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (770 PDB entries)
  8. 2545627Domain d2itna_: 2itn A: [165684]
    automated match to d1m14a_
    complexed with anp, mg; mutant

Details for d2itna_

PDB Entry: 2itn (more details), 2.47 Å

PDB Description: crystal structure of egfr kinase domain g719s mutation in complex with amp-pnp
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d2itna_:

Sequence, based on SEQRES records: (download)

>d2itna_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geapnqallrilketefkkikvlssgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
nfyralmdeedmddvvdadeylip

Sequence, based on observed residues (ATOM records): (download)

>d2itna_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geapnqallrilketefkkikvlssgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeevpikwmale
silhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvy
mimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhllmdeedmddvvdade
ylip

SCOPe Domain Coordinates for d2itna_:

Click to download the PDB-style file with coordinates for d2itna_.
(The format of our PDB-style files is described here.)

Timeline for d2itna_: