SCOPe 2.01: Domain d2isse_: 2iss E:

Lineage for d2isse_ (2iss E:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Hypothetical protein YaaE [102250] (3 species)
   glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis

7. Species Thermotoga maritima [TaxId:2336] [187876] (1 PDB entry)

8. Domain d2isse_: 2iss E: [165678]
   automated match to d1q7ra_
   complexed with 5rp, po4

Details for d2isse_

PDB Entry: 2iss, 2.9 Å

PDB Description: Structure of the PLP synthase Holoenzyme from Thermotoga maritima

PDB Compounds: (E:) Glutamine amidotransferase subunit pdxT

SCOPe Domain Sequences for d2isse_:

Sequence, based on SEQRES records:

>d2isse_ c.23.16.1 (E:) Hypothetical protein YaaE {Thermotoga maritima [TaxId: 2336]}
mkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemdm
deklverinnglpvfatcagvillakriknysqeklgvlditvernaygrqvesfetfve
ipavgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlh
ryflemv

Sequence, based on observed residues (ATOM records):

>d2isse_ c.23.16.1 (E:) Hypothetical protein YaaE {Thermotoga maritima [TaxId: 2336]}
mkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemdm
deklverinnglpvfatcagvillakrikqeklgvlditvernaygrqvesfetfveipa
vgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlhryf
lemv

Timeline for d2isse_:

• d2isse_ is new in SCOPe 2.01-stable
  
• d2isse_ appears in SCOPe 2.02
  
• d2isse_ appears in the current release, SCOPe 2.08