Lineage for d2isse_ (2iss E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858751Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2858891Protein Hypothetical protein YaaE [102250] (4 species)
    glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis
  7. 2858899Species Thermotoga maritima [TaxId:2336] [187876] (1 PDB entry)
  8. 2858901Domain d2isse_: 2iss E: [165678]
    Other proteins in same PDB: d2issa1, d2issa2, d2issb1, d2issb2, d2issc_, d2issd2
    automated match to d1q7ra_
    complexed with 5rp, po4

Details for d2isse_

PDB Entry: 2iss (more details), 2.9 Å

PDB Description: Structure of the PLP synthase Holoenzyme from Thermotoga maritima
PDB Compounds: (E:) Glutamine amidotransferase subunit pdxT

SCOPe Domain Sequences for d2isse_:

Sequence, based on SEQRES records: (download)

>d2isse_ c.23.16.1 (E:) Hypothetical protein YaaE {Thermotoga maritima [TaxId: 2336]}
mkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemdm
deklverinnglpvfatcagvillakriknysqeklgvlditvernaygrqvesfetfve
ipavgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlh
ryflemv

Sequence, based on observed residues (ATOM records): (download)

>d2isse_ c.23.16.1 (E:) Hypothetical protein YaaE {Thermotoga maritima [TaxId: 2336]}
mkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemdm
deklverinnglpvfatcagvillakrikqeklgvlditvernaygrqvesfetfveipa
vgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlhryf
lemv

SCOPe Domain Coordinates for d2isse_:

Click to download the PDB-style file with coordinates for d2isse_.
(The format of our PDB-style files is described here.)

Timeline for d2isse_: