Lineage for d2issd_ (2iss D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1160006Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1160007Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 1160117Protein Hypothetical protein YaaE [102250] (4 species)
    glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis
  7. 1160125Species Thermotoga maritima [TaxId:2336] [187876] (1 PDB entry)
  8. 1160126Domain d2issd_: 2iss D: [165677]
    automated match to d1q7ra_
    complexed with 5rp, po4

Details for d2issd_

PDB Entry: 2iss (more details), 2.9 Å

PDB Description: Structure of the PLP synthase Holoenzyme from Thermotoga maritima
PDB Compounds: (D:) Glutamine amidotransferase subunit pdxT

SCOPe Domain Sequences for d2issd_:

Sequence, based on SEQRES records: (download)

>d2issd_ c.23.16.1 (D:) Hypothetical protein YaaE {Thermotoga maritima [TaxId: 2336]}
hmkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemd
mdeklverinnglpvfatcagvillakriknysqeklgvlditvernaygrqvesfetfv
eipavgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrl
hryflemv

Sequence, based on observed residues (ATOM records): (download)

>d2issd_ c.23.16.1 (D:) Hypothetical protein YaaE {Thermotoga maritima [TaxId: 2336]}
hmkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemd
mdeklverinnglpvfatcagvillakrikqeklgvlditvernaygrqvesfetfveip
avgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlhry
flemv

SCOPe Domain Coordinates for d2issd_:

Click to download the PDB-style file with coordinates for d2issd_.
(The format of our PDB-style files is described here.)

Timeline for d2issd_: