Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein Hypothetical protein YaaE [102250] (4 species) glutamine amidotransferase of SNO/PDX2 family implicated in pyridoxine biosynthesis |
Species Thermotoga maritima [TaxId:2336] [187876] (1 PDB entry) |
Domain d2issd1: 2iss D:1-187 [165677] Other proteins in same PDB: d2issa1, d2issa2, d2issb1, d2issb2, d2issc_, d2issd2 automated match to d1q7ra_ complexed with 5rp, po4 |
PDB Entry: 2iss (more details), 2.9 Å
SCOPe Domain Sequences for d2issd1:
Sequence, based on SEQRES records: (download)
>d2issd1 c.23.16.1 (D:1-187) Hypothetical protein YaaE {Thermotoga maritima [TaxId: 2336]} mkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemdm deklverinnglpvfatcagvillakriknysqeklgvlditvernaygrqvesfetfve ipavgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlh ryflemv
>d2issd1 c.23.16.1 (D:1-187) Hypothetical protein YaaE {Thermotoga maritima [TaxId: 2336]} mkigvlgvqgdvrehvealhklgvetlivklpeqldmvdglilpggesttmirilkemdm deklverinnglpvfatcagvillakrikqeklgvlditvernaygrqvesfetfveipa vgkdpfraifiraprivetgknveilatydydpvlvkegnilactfhpeltddlrlhryf lemv
Timeline for d2issd1: