Lineage for d2hmzd_ (2hmz D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699908Superfamily a.24.4: Hemerythrin-like [47188] (1 family) (S)
  5. 2699909Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
    Iron-binding proteins
  6. 2699910Protein Hemerythrin [47190] (2 species)
  7. 2699930Species Sipunculid worm (Themiste dyscritum) [TaxId:6436] [47191] (4 PDB entries)
  8. 2699934Domain d2hmzd_: 2hmz D: [16567]
    complexed with act, fea

Details for d2hmzd_

PDB Entry: 2hmz (more details), 1.66 Å

PDB Description: the structures of met and azidomet hemerythrin at 1.66 angstroms resolution
PDB Compounds: (D:) hemerythrin

SCOPe Domain Sequences for d2hmzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmzd_ a.24.4.1 (D:) Hemerythrin {Sipunculid worm (Themiste dyscritum) [TaxId: 6436]}
gfpipdpycwdisfrtfytiiddehktlfngilllsqadnadhlnelrrctgkhflneqq
lmqasqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki

SCOPe Domain Coordinates for d2hmzd_:

Click to download the PDB-style file with coordinates for d2hmzd_.
(The format of our PDB-style files is described here.)

Timeline for d2hmzd_: