![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein automated matches [190142] (21 species) not a true protein |
![]() | Species Trichomonas vaginalis [TaxId:5722] [187838] (9 PDB entries) |
![]() | Domain d2iscb1: 2isc B:1-235 [165665] Other proteins in same PDB: d2isca2, d2iscb2, d2iscc2, d2iscd2, d2iscf2 automated match to d1a69a_ complexed with 223, po4 |
PDB Entry: 2isc (more details), 2.7 Å
SCOPe Domain Sequences for d2iscb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iscb1 c.56.2.1 (B:1-235) automated matches {Trichomonas vaginalis [TaxId: 5722]} atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem esaglfpiadlygaragcictvsdhilhheettaeerqnsfqnmmkialeaaikl
Timeline for d2iscb1: