Lineage for d2isag_ (2isa G:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2620683Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2620684Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2620685Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2620841Protein automated matches [190051] (12 species)
    not a true protein
  7. 2621040Species Vibrio salmonicida [TaxId:316275] [187875] (1 PDB entry)
  8. 2621047Domain d2isag_: 2isa G: [165662]
    automated match to d1e93a_
    complexed with cl, gol, hem

Details for d2isag_

PDB Entry: 2isa (more details), 1.97 Å

PDB Description: crystal structure of vibrio salmonicida catalase
PDB Compounds: (G:) catalase

SCOPe Domain Sequences for d2isag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2isag_ e.5.1.1 (G:) automated matches {Vibrio salmonicida [TaxId: 316275]}
skklttaagcpvahnqnvqtagkrgpqllqdvwfleklahfdreviperrmhakgsgayg
tftvthditkytkakifsdigkktdmfarfstvagergaadaerdirgfslkfyteegnw
dlagnntpvfflrdplkfpdlnhavkrdprtnmrsaknnwdfwtslpealhqvtivmsdr
gipatyrhmhgfgshtfsfinsdnerywvkfhfvsqqgiknlsdaeagelvgndreshqr
dlldsidnqdfpkwtlkvqimpeadaatvpynpfdltkvwphkdyplievgefelnrnpq
nyfaeveqaafnpanvvpgisfspdkmlqgrlfaygdaqryrlgvnhqhipvnaprcpvh
syhrdgamrvdgnfgstlgyepndqgqwaeqpdfsepplnldgaaahwdhrededyfsqp
gdlfglmtaekqailfdntarnlngvpkeiqlrhvthcykadpaygegigkllgfdisey
ns

SCOPe Domain Coordinates for d2isag_:

Click to download the PDB-style file with coordinates for d2isag_.
(The format of our PDB-style files is described here.)

Timeline for d2isag_: