SCOPe 2.08: Domain d2iqya1: 2iqy A:1-187

Lineage for d2iqya1 (2iqy A:1-187)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)

6. Protein automated matches [190720] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187873] (2 PDB entries)

8. Domain d2iqya1: 2iqy A:1-187 [165652]
   Other proteins in same PDB: d2iqya2
   automated match to d1b7aa_
   complexed with ca, cl

Details for d2iqya1

PDB Entry: 2iqy, 1.4 Å

PDB Description: rat phosphatidylethanolamine-binding protein

PDB Compounds: (A:) Phosphatidylethanolamine-binding protein 1

SCOPe Domain Sequences for d2iqya1:

Sequence; same for both SEQRES and ATOM records:

>d2iqya1 b.17.1.1 (A:1-187) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
maadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldp
gklytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhry
vwlvyeqeqplncdepilsnksgdnrgkfkvesfrkkyhlgapvagtcfqaewddsvpkl
hdqlagk

Timeline for d2iqya1:

• d2iqya1 first appeared in SCOPe 2.01, called d2iqya_
  
• d2iqya1 appears in SCOPe 2.07