SCOPe 2.08: Domain d2iqxb_: 2iqx B:

Lineage for d2iqxb_ (2iqx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)

6. Protein automated matches [190720] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187873] (2 PDB entries)

8. Domain d2iqxb_: 2iqx B: [165650]
   automated match to d1b7aa_
   complexed with ope; mutant

Details for d2iqxb_

PDB Entry: 2iqx, 2.2 Å

PDB Description: rat phosphatidylethanolamine-binding protein containing the s153e mutation in the complex with o-phosphorylethanolamine

PDB Compounds: (B:) Phosphatidylethanolamine-binding protein 1

SCOPe Domain Sequences for d2iqxb_:

Sequence; same for both SEQRES and ATOM records:

>d2iqxb_ b.17.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldpg
klytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhryv
wlvyeqeqplncdepilsnksgdnrgkfkveefrkkyhlgapvagtcfqaewddsvpklh
dqlag

Timeline for d2iqxb_:

• d2iqxb_ first appeared in SCOPe 2.01
  
• d2iqxb_ appears in SCOPe 2.07