Lineage for d2iqxa_ (2iqx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774039Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2774063Protein automated matches [190720] (3 species)
    not a true protein
  7. 2774066Species Norway rat (Rattus norvegicus) [TaxId:10116] [187873] (2 PDB entries)
  8. 2774068Domain d2iqxa_: 2iqx A: [165649]
    automated match to d1b7aa_
    complexed with ope; mutant

Details for d2iqxa_

PDB Entry: 2iqx (more details), 2.2 Å

PDB Description: rat phosphatidylethanolamine-binding protein containing the s153e mutation in the complex with o-phosphorylethanolamine
PDB Compounds: (A:) Phosphatidylethanolamine-binding protein 1

SCOPe Domain Sequences for d2iqxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iqxa_ b.17.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aadisqwagplslqevdeppqhalrvdyggvtvdelgkvltptqvmnrpssiswdgldpg
klytlvltdpdapsrkdpkfrewhhflvvnmkgndissgtvlseyvgsgppkdtglhryv
wlvyeqeqplncdepilsnksgdnrgkfkveefrkkyhlgapvagtcfqaewddsvpklh
dqlag

SCOPe Domain Coordinates for d2iqxa_:

Click to download the PDB-style file with coordinates for d2iqxa_.
(The format of our PDB-style files is described here.)

Timeline for d2iqxa_: