Lineage for d2iq7g_ (2iq7 G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806195Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806196Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 1806251Family b.80.1.3: Galacturonase [51137] (3 proteins)
    this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain
  6. 1806278Protein automated matches [190875] (1 species)
    not a true protein
  7. 1806279Species Colletotrichum lupini [TaxId:145971] [188228] (1 PDB entry)
  8. 1806286Domain d2iq7g_: 2iq7 G: [165648]
    automated match to d1nhca_
    complexed with acy, peg, pg4

Details for d2iq7g_

PDB Entry: 2iq7 (more details), 1.94 Å

PDB Description: crystal structure of the polygalacturonase from colletotrichum lupini and its implications for the interaction with polygalacturonase- inhibiting proteins
PDB Compounds: (G:) endopolygalacturonase

SCOPe Domain Sequences for d2iq7g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iq7g_ b.80.1.3 (G:) automated matches {Colletotrichum lupini [TaxId: 145971]}
asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac

SCOPe Domain Coordinates for d2iq7g_:

Click to download the PDB-style file with coordinates for d2iq7g_.
(The format of our PDB-style files is described here.)

Timeline for d2iq7g_: