Class b: All beta proteins [48724] (176 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.1: Pectin lyase-like [51126] (12 families) superhelix turns are made of 3 strands each |
Family b.80.1.3: Galacturonase [51137] (3 proteins) this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain |
Protein automated matches [190875] (1 species) not a true protein |
Species Colletotrichum lupini [TaxId:145971] [188228] (1 PDB entry) |
Domain d2iq7g_: 2iq7 G: [165648] automated match to d1nhca_ complexed with acy, peg, pg4 |
PDB Entry: 2iq7 (more details), 1.94 Å
SCOPe Domain Sequences for d2iq7g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iq7g_ b.80.1.3 (G:) automated matches {Colletotrichum lupini [TaxId: 145971]} asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
Timeline for d2iq7g_: