Lineage for d2ipxa_ (2ipx A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146764Species Human (Homo sapiens) [TaxId:9606] [187871] (15 PDB entries)
  8. 2146773Domain d2ipxa_: 2ipx A: [165639]
    automated match to d1prya_
    complexed with ca, mta

Details for d2ipxa_

PDB Entry: 2ipx (more details), 1.82 Å

PDB Description: Human Fibrillarin
PDB Compounds: (A:) rRNA 2'-O-methyltransferase fibrillarin

SCOPe Domain Sequences for d2ipxa_:

Sequence, based on SEQRES records: (download)

>d2ipxa_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvephrhegvficrgkedalvtknlvpgesvygekrvsisegddkieyrawnpfrsklaa
ailggvdqihikpgakvlylgaasgttvshvsdivgpdglvyavefshrsgrdlinlakk
rtniipviedarhphkyrmliamvdvifadvaqpdqtrivalnahtflrngghfvisika
ncidstasaeavfasevkkmqqenmkpqeqltlepyerdhavvvgvyrp

Sequence, based on observed residues (ATOM records): (download)

>d2ipxa_ c.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvephrhegvficrlvtknlvpgesvygekrvsiskieyrawnpfrsklaaailggvdqi
hikpgakvlylgaasgttvshvsdivgpdglvyavefshrsgrdlinlakkrtniipvie
darhphkyrmliamvdvifadvaqpdqtrivalnahtflrngghfvisikancidstasa
eavfasevkkmqqenmkpqeqltlepyerdhavvvgvyrp

SCOPe Domain Coordinates for d2ipxa_:

Click to download the PDB-style file with coordinates for d2ipxa_.
(The format of our PDB-style files is described here.)

Timeline for d2ipxa_: