SCOPe 2.01: Domain d2ipma_: 2ipm A:

Lineage for d2ipma_ (2ipm A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein Galactose/glucose-binding protein [53830] (2 species)

7. Species Escherichia coli [TaxId:562] [53831] (9 PDB entries)

8. Domain d2ipma_: 2ipm A: [165637]
   automated match to d1glga_
   complexed with bgc, ca; mutant

Details for d2ipma_

PDB Entry: 2ipm, 1.12 Å

PDB Description: crystal structure of a disulfide mutant glucose binding protein

PDB Compounds: (A:) D-galactose-binding periplasmic protein

SCOPe Domain Sequences for d2ipma_:

Sequence; same for both SEQRES and ATOM records:

>d2ipma_ c.93.1.1 (A:) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]}
adtrigvtiykyddcfmsvvrkaieqdakaapdvqllmndsqndqskqndqidvllakgv
kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgiiqg
dliakhwaanqgwdlnkdgqiqfvllkgepghpdaearttyvikelndkgikteqlqldt
amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdacpe
alalvksgalagtvlndannqakatfdlaknladgkgaadgtnwkidnkvvrvpyvgvdk
dnlaefs

Timeline for d2ipma_:

• d2ipma_ is new in SCOPe 2.01-stable
  
• d2ipma_ appears in SCOPe 2.02
  
• d2ipma_ appears in the current release, SCOPe 2.08