Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins) |
Protein Galactose/glucose-binding protein [53830] (2 species) |
Species Escherichia coli [TaxId:562] [53831] (9 PDB entries) |
Domain d2ipma_: 2ipm A: [165637] automated match to d1glga_ complexed with bgc, ca; mutant |
PDB Entry: 2ipm (more details), 1.12 Å
SCOPe Domain Sequences for d2ipma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipma_ c.93.1.1 (A:) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} adtrigvtiykyddcfmsvvrkaieqdakaapdvqllmndsqndqskqndqidvllakgv kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgiiqg dliakhwaanqgwdlnkdgqiqfvllkgepghpdaearttyvikelndkgikteqlqldt amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdacpe alalvksgalagtvlndannqakatfdlaknladgkgaadgtnwkidnkvvrvpyvgvdk dnlaefs
Timeline for d2ipma_: