Lineage for d2ipma_ (2ipm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2912948Protein Galactose/glucose-binding protein [53830] (2 species)
  7. 2912949Species Escherichia coli [TaxId:562] [53831] (9 PDB entries)
  8. 2912951Domain d2ipma_: 2ipm A: [165637]
    automated match to d1glga_
    complexed with bgc, ca; mutant

Details for d2ipma_

PDB Entry: 2ipm (more details), 1.12 Å

PDB Description: crystal structure of a disulfide mutant glucose binding protein
PDB Compounds: (A:) D-galactose-binding periplasmic protein

SCOPe Domain Sequences for d2ipma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipma_ c.93.1.1 (A:) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]}
adtrigvtiykyddcfmsvvrkaieqdakaapdvqllmndsqndqskqndqidvllakgv
kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgiiqg
dliakhwaanqgwdlnkdgqiqfvllkgepghpdaearttyvikelndkgikteqlqldt
amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdacpe
alalvksgalagtvlndannqakatfdlaknladgkgaadgtnwkidnkvvrvpyvgvdk
dnlaefs

SCOPe Domain Coordinates for d2ipma_:

Click to download the PDB-style file with coordinates for d2ipma_.
(The format of our PDB-style files is described here.)

Timeline for d2ipma_: