Lineage for d2ipja_ (2ipj A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2437839Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)
  7. 2437840Species Human (Homo sapiens), type III [TaxId:9606] [69383] (16 PDB entries)
    bile acid binding protein
  8. 2437853Domain d2ipja_: 2ipj A: [165634]
    automated match to d1j96a_
    complexed with bme, edo, ffa, nap, so4; mutant

Details for d2ipja_

PDB Entry: 2ipj (more details), 1.8 Å

PDB Description: crystal structure of h3alpha-hydroxysteroid dehydrogenase type 3 mutant y24a in complex with nadp+ and epi-testosterone
PDB Compounds: (A:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d2ipja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipja_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
skyqcvklndghfmpvlgfgtaapaevpkskaleavklaieagfhhidsahvynneeqvg
lairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvsv
kpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpgl
kykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlc
alakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrn
vryltldifagppnypfsdey

SCOPe Domain Coordinates for d2ipja_:

Click to download the PDB-style file with coordinates for d2ipja_.
(The format of our PDB-style files is described here.)

Timeline for d2ipja_: