Lineage for d1a7vb_ (1a7v B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699789Protein Cytochrome c' [47180] (9 species)
  7. 2699831Species Rhodopseudomonas palustris [TaxId:1076] [47187] (2 PDB entries)
  8. 2699835Domain d1a7vb_: 1a7v B: [16563]
    complexed with hem

Details for d1a7vb_

PDB Entry: 1a7v (more details), 2.3 Å

PDB Description: cytochrome c' from rhodopseudomonas palustris
PDB Compounds: (B:) cytochrome c'

SCOPe Domain Sequences for d1a7vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7vb_ a.24.3.2 (B:) Cytochrome c' {Rhodopseudomonas palustris [TaxId: 1076]}
qtdviaqrkailkqmgeatkpiaamlkgeakfdqavvqkslaaiaddskklpalfpadsk
tggdtaalpkiwedkakfddlfaklaaaataaqgtikdeaslkaniggvlgnckschddf
rakks

SCOPe Domain Coordinates for d1a7vb_:

Click to download the PDB-style file with coordinates for d1a7vb_.
(The format of our PDB-style files is described here.)

Timeline for d1a7vb_: