| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
| Protein automated matches [190296] (9 species) not a true protein |
| Species Thermoanaerobacter tengcongensis [TaxId:119072] [187869] (1 PDB entry) |
| Domain d2ioyb_: 2ioy B: [165629] automated match to d1urpa_ complexed with rip |
PDB Entry: 2ioy (more details), 1.9 Å
SCOPe Domain Sequences for d2ioyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioyb_ c.93.1.1 (B:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
ktiglvistlnnpffvtlkngaeekakelgykiivedsqndsskelsnvedliqqkvdvl
linpvdsdavvtaikeansknipvitidrsanggdvvchiasdnvkggemaaefiakalk
gkgnvvelegipgasaardrgkgfdeaiakypdikivakqaadfdrskglsvmenilqaq
pkidavfaqndemalgaikaieaanrqgiivvgfdgtedalkaikegkmaatiaqqpalm
gslgvemadkylkgekipnfipaelklitkenvq
Timeline for d2ioyb_: