SCOPe 2.01: Domain d2ioyb_: 2ioy B:

Lineage for d2ioyb_ (2ioy B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein automated matches [190296] (4 species)
   not a true protein

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [187869] (1 PDB entry)

8. Domain d2ioyb_: 2ioy B: [165629]
   automated match to d1urpa_
   complexed with rip

Details for d2ioyb_

PDB Entry: 2ioy, 1.9 Å

PDB Description: crystal structure of thermoanaerobacter tengcongensis ribose binding protein

PDB Compounds: (B:) Periplasmic sugar-binding protein

SCOPe Domain Sequences for d2ioyb_:

Sequence; same for both SEQRES and ATOM records:

>d2ioyb_ c.93.1.1 (B:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
ktiglvistlnnpffvtlkngaeekakelgykiivedsqndsskelsnvedliqqkvdvl
linpvdsdavvtaikeansknipvitidrsanggdvvchiasdnvkggemaaefiakalk
gkgnvvelegipgasaardrgkgfdeaiakypdikivakqaadfdrskglsvmenilqaq
pkidavfaqndemalgaikaieaanrqgiivvgfdgtedalkaikegkmaatiaqqpalm
gslgvemadkylkgekipnfipaelklitkenvq

Timeline for d2ioyb_:

• d2ioyb_ is new in SCOPe 2.01-stable
  
• d2ioyb_ appears in SCOPe 2.02
  
• d2ioyb_ appears in the current release, SCOPe 2.08