Lineage for d2iooa_ (2ioo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2768088Protein automated matches [190198] (2 species)
    not a true protein
  7. 2768226Species Mouse (Mus musculus) [TaxId:10090] [187745] (7 PDB entries)
  8. 2768234Domain d2iooa_: 2ioo A: [165627]
    automated match to d1hu8a_
    complexed with zn

Details for d2iooa_

PDB Entry: 2ioo (more details), 2.02 Å

PDB Description: crystal structure of the mouse p53 core domain
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2iooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iooa_ b.2.5.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qktyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvra
maiykksqhmtevvrrcphhercsdgdglappqhlirvegnlypeyledrqtfrhsvvvp
yeppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpg
rdrrtee

SCOPe Domain Coordinates for d2iooa_:

Click to download the PDB-style file with coordinates for d2iooa_.
(The format of our PDB-style files is described here.)

Timeline for d2iooa_: