Lineage for d2iohc_ (2ioh C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1010783Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 1010807Protein automated matches [190718] (1 species)
    not a true protein
  7. 1010808Species Bacillus cereus [TaxId:1396] [187870] (2 PDB entries)
  8. 1010813Domain d2iohc_: 2ioh C: [165623]
    automated match to d1rdfa_
    complexed with mg, po4; mutant

Details for d2iohc_

PDB Entry: 2ioh (more details), 2.9 Å

PDB Description: crystal structure of phosphonoacetaldehyde hydrolase with a k53r mutation
PDB Compounds: (C:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d2iohc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iohc_ c.108.1.3 (C:) automated matches {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllridhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehie

SCOPe Domain Coordinates for d2iohc_:

Click to download the PDB-style file with coordinates for d2iohc_.
(The format of our PDB-style files is described here.)

Timeline for d2iohc_: