Lineage for d2iohb_ (2ioh B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919616Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919640Protein automated matches [190718] (1 species)
    not a true protein
  7. 2919641Species Bacillus cereus [TaxId:1396] [187870] (2 PDB entries)
  8. 2919643Domain d2iohb_: 2ioh B: [165622]
    automated match to d1rdfa_
    complexed with mg, po4; mutant

Details for d2iohb_

PDB Entry: 2ioh (more details), 2.9 Å

PDB Description: crystal structure of phosphonoacetaldehyde hydrolase with a k53r mutation
PDB Compounds: (B:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d2iohb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iohb_ c.108.1.3 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllridhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehie

SCOPe Domain Coordinates for d2iohb_:

Click to download the PDB-style file with coordinates for d2iohb_.
(The format of our PDB-style files is described here.)

Timeline for d2iohb_: