![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein automated matches [190718] (1 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:1396] [187870] (2 PDB entries) |
![]() | Domain d2ioha_: 2ioh A: [165621] automated match to d1rdfa_ complexed with mg, po4; mutant |
PDB Entry: 2ioh (more details), 2.9 Å
SCOPe Domain Sequences for d2ioha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioha_ c.108.1.3 (A:) automated matches {Bacillus cereus [TaxId: 1396]} kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllridhvraltemp riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf tietmqelesvmehie
Timeline for d2ioha_: