SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ioha_ (2ioh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148701Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 protein domains)
    the insertion subdomain is a 4-helical bundle
  6. 2148725Protein automated matches [190718] (1 species)
    not a true protein
  7. 2148726Species Bacillus cereus [TaxId:1396] [187870] (2 PDB entries)
  8. 2148729Domain d2ioha_: 2ioh A: [165621]
    automated match to d1rdfa_
    complexed with mg, po4; mutant

Details for d2ioha_

PDB Entry: 2ioh (more details), 2.9 Å

PDB Description: Crystal structure of phosphonoacetaldehyde hydrolase with a K53R mutation
PDB Compounds: (A:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d2ioha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ioha_ c.108.1.3 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllridhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehie

SCOPe Domain Coordinates for d2ioha_:

Click to download the PDB-style file with coordinates for d2ioha_.
(The format of our PDB-style files is described here.)

Timeline for d2ioha_: