SCOPe 2.08: Domain d2iofk_: 2iof K:

Lineage for d2iofk_ (2iof K:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein automated matches [190718] (1 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [187870] (2 PDB entries)

8. Domain d2iofk_: 2iof K: [165620]
   automated match to d1rdfa_
   complexed with mg, po4

Details for d2iofk_

PDB Entry: 2iof, 2.5 Å

PDB Description: crystal structure of phosphonoacetaldehyde hydrolase with sodium borohydride-reduced substrate intermediate

PDB Compounds: (K:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d2iofk_:

Sequence; same for both SEQRES and ATOM records:

>d2iofk_ c.108.1.3 (K:) automated matches {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehie

Timeline for d2iofk_:

• d2iofk_ first appeared in SCOPe 2.01
  
• d2iofk_ appears in SCOPe 2.07