| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins) the insertion subdomain is a 4-helical bundle |
| Protein automated matches [190718] (1 species) not a true protein |
| Species Bacillus cereus [TaxId:1396] [187870] (2 PDB entries) |
| Domain d2iofk_: 2iof K: [165620] automated match to d1rdfa_ complexed with mg, po4 |
PDB Entry: 2iof (more details), 2.5 Å
SCOPe Domain Sequences for d2iofk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iofk_ c.108.1.3 (K:) automated matches {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspingvkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehie
Timeline for d2iofk_: