Lineage for d2infc_ (2inf C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840547Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2840594Family c.1.22.0: automated matches [191464] (1 protein)
    not a true family
  6. 2840595Protein automated matches [190717] (5 species)
    not a true protein
  7. 2840599Species Bacillus subtilis [TaxId:1423] [187867] (1 PDB entry)
  8. 2840602Domain d2infc_: 2inf C: [165615]
    automated match to d1jpia_

Details for d2infc_

PDB Entry: 2inf (more details), 2.3 Å

PDB Description: crystal structure of uroporphyrinogen decarboxylase from bacillus subtilis
PDB Compounds: (C:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d2infc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2infc_ c.1.22.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
tfnetflkaargekadhtpvwymrqagrsqpeyrklkekyglfeithqpelcayvtrlpv
eqygvdaailykdimtplpsigvdveikngigpvidqpirsladieklgqidpeqdvpyv
letikllvneqlnvpligfsgapftlasymteggpsknynktkafmysmpdawnllmskl
admiivyvkaqikagakaiqifdswvgalnqadyrtyikpvmnrifselakenvplimfg
vgashlagdwhdlpldvvgldwrlgidearskgitktvqgnldpsillapwevieqktke
ildqgmesdgfifnlghgvfpdvspevlkkltafvheysqnkkm

SCOPe Domain Coordinates for d2infc_:

Click to download the PDB-style file with coordinates for d2infc_.
(The format of our PDB-style files is described here.)

Timeline for d2infc_: