Lineage for d2infb_ (2inf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089841Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2089888Family c.1.22.0: automated matches [191464] (1 protein)
    not a true family
  6. 2089889Protein automated matches [190717] (5 species)
    not a true protein
  7. 2089893Species Bacillus subtilis [TaxId:1423] [187867] (1 PDB entry)
  8. 2089895Domain d2infb_: 2inf B: [165614]
    automated match to d1jpia_

Details for d2infb_

PDB Entry: 2inf (more details), 2.3 Å

PDB Description: crystal structure of uroporphyrinogen decarboxylase from bacillus subtilis
PDB Compounds: (B:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d2infb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2infb_ c.1.22.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tfnetflkaargekadhtpvwymrqagrsqpeyrklkekyglfeithqpelcayvtrlpv
eqygvdaailykdimtplpsigvdveikngigpvidqpirsladieklgqidpeqdvpyv
letikllvneqlnvpligfsgapftlasymteggpsknynktkafmysmpdawnllmskl
admiivyvkaqikagakaiqifdswvgalnqadyrtyikpvmnrifselakenvplimfg
vgashlagdwhdlpldvvgldwrlgidearskgitktvqgnldpsillapwevieqktke
ildqgmesdgfifnlghgvfpdvspevlkkltafvheysqnkkm

SCOPe Domain Coordinates for d2infb_:

Click to download the PDB-style file with coordinates for d2infb_.
(The format of our PDB-style files is described here.)

Timeline for d2infb_: