SCOPe 2.06: Domain d2infa_: 2inf A:

Lineage for d2infa_ (2inf A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.22: UROD/MetE-like [51726] (3 families)

5. Family c.1.22.0: automated matches [191464] (1 protein)
   not a true family

6. Protein automated matches [190717] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187867] (1 PDB entry)

8. Domain d2infa_: 2inf A: [165613]
   automated match to d1jpia_

Details for d2infa_

PDB Entry: 2inf, 2.3 Å

PDB Description: crystal structure of uroporphyrinogen decarboxylase from bacillus subtilis

PDB Compounds: (A:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d2infa_:

Sequence; same for both SEQRES and ATOM records:

>d2infa_ c.1.22.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tfnetflkaargekadhtpvwymrqagrsqpeyrklkekyglfeithqpelcayvtrlpv
eqygvdaailykdimtplpsigvdveikngigpvidqpirsladieklgqidpeqdvpyv
letikllvneqlnvpligfsgapftlasymteggpsknynktkafmysmpdawnllmskl
admiivyvkaqikagakaiqifdswvgalnqadyrtyikpvmnrifselakenvplimfg
vgashlagdwhdlpldvvgldwrlgidearskgitktvqgnldpsillapwevieqktke
ildqgmesdgfifnlghgvfpdvspevlkkltafvheysqnkkm

Timeline for d2infa_:

• d2infa_ first appeared in SCOPe 2.01
  
• d2infa_ appears in SCOPe 2.05
  
• d2infa_ appears in SCOPe 2.07
  
• d2infa_ appears in the current release, SCOPe 2.08