SCOPe 2.05: Domain d2ikua_: 2iku A:

Lineage for d2ikua_ (2iku A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Chymosin (synonym: renin) [50667] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50669] (66 PDB entries)

8. Domain d2ikua_: 2iku A: [165604]
   automated match to d1bila_
   complexed with liy

Details for d2ikua_

PDB Entry: 2iku, 2.6 Å

PDB Description: crystal structure of human renin complexed with inhibitors

PDB Compounds: (A:) renin

SCOPe Domain Sequences for d2ikua_:

Sequence; same for both SEQRES and ATOM records:

>d2ikua_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
gnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhkl
fdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlae
fdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdp
qhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklm
ealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiham
dippptgptwalgatfirkfytefdrrnnrigfalar

Timeline for d2ikua_:

• d2ikua_ first appeared in SCOPe 2.01
  
• d2ikua_ appears in SCOPe 2.04
  
• d2ikua_ appears in SCOPe 2.06
  
• d2ikua_ appears in the current release, SCOPe 2.08