Lineage for d2ikoa_ (2iko A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060651Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2060659Species Human (Homo sapiens) [TaxId:9606] [50669] (76 PDB entries)
  8. 2060664Domain d2ikoa_: 2iko A: [165602]
    automated match to d1bila_
    complexed with 7ig

Details for d2ikoa_

PDB Entry: 2iko (more details), 1.9 Å

PDB Description: Crystal Structure of Human Renin Complexed with Inhibitor
PDB Compounds: (A:) renin

SCOPe Domain Sequences for d2ikoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ikoa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
lgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhk
lfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmla
efdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsd
pqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssiekl
mealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiha
mdippptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d2ikoa_:

Click to download the PDB-style file with coordinates for d2ikoa_.
(The format of our PDB-style files is described here.)

Timeline for d2ikoa_: