SCOPe 2.08: Domain d1nbba_: 1nbb A:

Lineage for d1nbba_ (1nbb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein Cytochrome c' [47180] (9 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [47186] (4 PDB entries)

8. Domain d1nbba_: 1nbb A: [16560]
   complexed with hem, nbn

Details for d1nbba_

PDB Entry: 1nbb, 2.4 Å

PDB Description: n-butylisocyanide bound rhodobacter capsulatus cytochrome c'

PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d1nbba_:

Sequence; same for both SEQRES and ATOM records:

>d1nbba_ a.24.3.2 (A:) Cytochrome c' {Rhodobacter capsulatus [TaxId: 1061]}
adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
stdlpgqteakaaiwanmddfgakgkamheaggaviaaanagdgaafgaalqklggtcka
chddyreed

Timeline for d1nbba_:

• d1nbba_ first appeared (with stable ids) in SCOP 1.55
  
• d1nbba_ appears in SCOPe 2.07