Lineage for d1cpra_ (1cpr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699789Protein Cytochrome c' [47180] (9 species)
  7. 2699818Species Rhodobacter capsulatus [TaxId:1061] [47186] (4 PDB entries)
  8. 2699822Domain d1cpra_: 1cpr A: [16559]
    complexed with hem, zn

Details for d1cpra_

PDB Entry: 1cpr (more details), 2.1 Å

PDB Description: st. louis cytochrome c' from the purple phototropic bacterium, rhodobacter capsulatus
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d1cpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpra_ a.24.3.2 (A:) Cytochrome c' {Rhodobacter capsulatus [TaxId: 1061]}
adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
stdlpgqteakaaiwanmddfgakgkamhdaggaviaaanagdgaafgaalqklggtcka
chddyreed

SCOPe Domain Coordinates for d1cpra_:

Click to download the PDB-style file with coordinates for d1cpra_.
(The format of our PDB-style files is described here.)

Timeline for d1cpra_: