| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.1: ROP protein [47380] (1 family) ![]() automatically mapped to Pfam PF01815 |
| Family a.30.1.1: ROP protein [47381] (1 protein) |
| Protein ROP protein [47382] (1 species) |
| Species Escherichia coli [TaxId:562] [47383] (18 PDB entries) Uniprot P03051 |
| Domain d2ijja_: 2ijj A: [165587] automated match to d1rpra_ mutant |
PDB Entry: 2ijj (more details), 1.9 Å
SCOPe Domain Sequences for d2ijja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ijja_ a.30.1.1 (A:) ROP protein {Escherichia coli [TaxId: 562]}
gtkqektalnmaryirsqtltlleklneldadeqadiceslhdhadelyrsclarfgd
Timeline for d2ijja_: