SCOPe 2.05: Domain d2ii8g_: 2ii8 G:

Lineage for d2ii8g_ (2ii8 G:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll

4. Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families)

5. Family b.123.1.0: automated matches [191462] (1 protein)
   not a true family

6. Protein automated matches [190713] (1 species)
   not a true protein

7. Species Anabaena sp. [TaxId:1167] [187862] (4 PDB entries)

8. Domain d2ii8g_: 2ii8 G: [165569]
   automated match to d1nc7b_

Details for d2ii8g_

PDB Entry: 2ii8, 2.1 Å

PDB Description: anabaena sensory rhodopsin transducer

PDB Compounds: (G:) Anabaena sensory rhodopsin transducer protein

SCOPe Domain Sequences for d2ii8g_:

Sequence, based on SEQRES records:

>d2ii8g_ b.123.1.0 (G:) automated matches {Anabaena sp. [TaxId: 1167]}
slsigrtcwaiaegyippygngpepqfishetvcilnagdedahveitiyysdkepvgpy
rltvparrtkhvrfndlndpapiphdtdfasviqsnvpivvqht

Sequence, based on observed residues (ATOM records):

>d2ii8g_ b.123.1.0 (G:) automated matches {Anabaena sp. [TaxId: 1167]}
slsigrtcwaiaegyippetvcilnagdedahveitiyysdkepvgpyrltvparrtkhv
rfndlndpapiphdtdfasviqsnvpivvqht

Timeline for d2ii8g_:

• d2ii8g_ first appeared in SCOPe 2.01
  
• d2ii8g_ appears in SCOPe 2.04
  
• d2ii8g_ appears in SCOPe 2.06
  
• d2ii8g_ appears in the current release, SCOPe 2.08