Lineage for d2ii7h_ (2ii7 H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2088367Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
  4. 2088368Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families) (S)
  5. 2088376Family b.123.1.0: automated matches [191462] (1 protein)
    not a true family
  6. 2088377Protein automated matches [190713] (1 species)
    not a true protein
  7. 2088378Species Anabaena sp. [TaxId:1167] [187862] (4 PDB entries)
  8. 2088399Domain d2ii7h_: 2ii7 H: [165562]
    automated match to d1nc7b_

Details for d2ii7h_

PDB Entry: 2ii7 (more details), 2.8 Å

PDB Description: Anabaena sensory rhodopsin transducer
PDB Compounds: (H:) Anabaena sensory rhodopsin transducer protein

SCOPe Domain Sequences for d2ii7h_:

Sequence, based on SEQRES records: (download)

>d2ii7h_ b.123.1.0 (H:) automated matches {Anabaena sp. [TaxId: 1167]}
slsigrtcwaiaegyippygngpepqfishetvcilnagdedahveitiyysdkepvgpy
rltvparrtkhvrfndlndpapiphdtdfasviqsnvpivvqhtrldsrqaenallst

Sequence, based on observed residues (ATOM records): (download)

>d2ii7h_ b.123.1.0 (H:) automated matches {Anabaena sp. [TaxId: 1167]}
slsigrtcwaiaegyippetvcilnagdedahveitiyysdkepvgpyrltvparrtkhv
rfndlndpapiphdtdfasviqsnvpivvqhtrldsrqaenallst

SCOPe Domain Coordinates for d2ii7h_:

Click to download the PDB-style file with coordinates for d2ii7h_.
(The format of our PDB-style files is described here.)

Timeline for d2ii7h_: