SCOPe 2.03: Domain d2ii7f_: 2ii7 F:

Lineage for d2ii7f_ (2ii7 F:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll

4. Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families)

5. Family b.123.1.0: automated matches [191462] (1 protein)
   not a true family

6. Protein automated matches [190713] (1 species)
   not a true protein

7. Species Anabaena sp. [TaxId:1167] [187862] (4 PDB entries)

8. Domain d2ii7f_: 2ii7 F: [165560]
   automated match to d1nc7b_

Details for d2ii7f_

PDB Entry: 2ii7, 2.8 Å

PDB Description: Anabaena sensory rhodopsin transducer

PDB Compounds: (F:) Anabaena sensory rhodopsin transducer protein

SCOPe Domain Sequences for d2ii7f_:

Sequence, based on SEQRES records:

>d2ii7f_ b.123.1.0 (F:) automated matches {Anabaena sp. [TaxId: 1167]}
lsigrtcwaiaegyippygngpepqfishetvcilnagdedahveitiyysdkepvgpyr
ltvparrtkhvrfndlndpapiphdtdfasviqsnvpivvqht

Sequence, based on observed residues (ATOM records):

>d2ii7f_ b.123.1.0 (F:) automated matches {Anabaena sp. [TaxId: 1167]}
lsigrtcwaiaegyippetvcilnagdedahveitiyysdkepvgpyrltvparrtkhvr
fndlndpapiphdtdfasviqsnvpivvqht

Timeline for d2ii7f_:

• d2ii7f_ first appeared in SCOPe 2.01
  
• d2ii7f_ appears in SCOPe 2.02
  
• d2ii7f_ appears in SCOPe 2.04
  
• d2ii7f_ appears in the current release, SCOPe 2.08