Lineage for d1cpq__ (1cpq -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies) Superfamily a.24.3: Cytochromes [47175] (2 families) 
Family a.24.3.2: Cytochrome c' [47179] (1 protein) Protein Cytochrome c' [47180] (7 species) 
Species Rhodobacter capsulatus [TaxId:1061] [47186] (4 PDB entries) 
Domain d1cpq__: 1cpq - [16556]
Details for d1cpq__
PDB Entry: 1cpq (more details), 1.72 Å
PDB Description: cytochrome c' from rhodopseudomonas capsulata
SCOP Domain Sequences for d1cpq__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cpq__ a.24.3.2 (-) Cytochrome c' {Rhodobacter capsulatus}
adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
stdlpgqteakaaiwanmddfgakgkamheaggaviaaanagdgaafgaalqklggtcka
chddyreed
SCOP Domain Coordinates for d1cpq__:
Click to download the PDB-style file with coordinates for d1cpq__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cpq__:
- d1cpq__ first appeared (with stable ids) in SCOP 1.55
- d1cpq__ appears in SCOP 1.59
- d1cpq__ appears in the current release, SCOPe 2.08, called d1cpqa_
View in 3D