Lineage for d1cpq__ (1cpq -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2278Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
  5. 2287Family a.24.3.2: Cytochrome c' [47179] (1 protein)
  6. 2288Protein Cytochrome c' [47180] (7 species)
  7. 2300Species Rhodobacter capsulatus [TaxId:1061] [47186] (4 PDB entries)
  8. 2301Domain d1cpq__: 1cpq - [16556]

Details for d1cpq__

PDB Entry: 1cpq (more details), 1.72 Å

PDB Description: cytochrome c' from rhodopseudomonas capsulata

SCOP Domain Sequences for d1cpq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpq__ a.24.3.2 (-) Cytochrome c' {Rhodobacter capsulatus}
adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
stdlpgqteakaaiwanmddfgakgkamheaggaviaaanagdgaafgaalqklggtcka
chddyreed

SCOP Domain Coordinates for d1cpq__:

Click to download the PDB-style file with coordinates for d1cpq__.
(The format of our PDB-style files is described here.)

Timeline for d1cpq__: