| Class b: All beta proteins [48724] (180 folds) |
| Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families) ![]() decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243 |
| Family b.23.3.0: automated matches [191463] (1 protein) not a true family |
| Protein automated matches [190714] (2 species) not a true protein |
| Species Bacillus halodurans [TaxId:86665] [187863] (1 PDB entry) |
| Domain d2ii1d_: 2ii1 D: [165553] Other proteins in same PDB: d2ii1a2 automated match to d2f4la1 complexed with ca |
PDB Entry: 2ii1 (more details), 1.95 Å
SCOPe Domain Sequences for d2ii1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ii1d_ b.23.3.0 (D:) automated matches {Bacillus halodurans [TaxId: 86665]}
mirlsnentiffmdkenvpiascqsgdtvifetkdcfsdqitneeqaltsidfnrvnpat
gplyvegarrgdmleieildikvgkqgvmtaapglgalgeslnspttklfpiegddvvys
tglrlplqpmigvigtappgepinngtpgphggnldtkdikpgttvylpvevdgallalg
dlhaamgdgeilicgveiagtvtlkvnvkkermfplpalktdthfmtiasaetldaaavq
atknmatflanrtalsieeagmllsgagdlyvsqivnplktarfslalhyfeklgvd
Timeline for d2ii1d_:
View in 3DDomains from other chains: (mouse over for more information) d2ii1a1, d2ii1a2, d2ii1b_, d2ii1c_ |