Lineage for d2ii1b_ (2ii1 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777761Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families) (S)
    decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243
  5. 2777769Family b.23.3.0: automated matches [191463] (1 protein)
    not a true family
  6. 2777770Protein automated matches [190714] (2 species)
    not a true protein
  7. 2777771Species Bacillus halodurans [TaxId:86665] [187863] (1 PDB entry)
  8. 2777773Domain d2ii1b_: 2ii1 B: [165551]
    Other proteins in same PDB: d2ii1a2
    automated match to d2f4la1
    complexed with ca

Details for d2ii1b_

PDB Entry: 2ii1 (more details), 1.95 Å

PDB Description: crystal structure of acetamidase (10172637) from bacillus halodurans at 1.95 a resolution
PDB Compounds: (B:) Acetamidase

SCOPe Domain Sequences for d2ii1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ii1b_ b.23.3.0 (B:) automated matches {Bacillus halodurans [TaxId: 86665]}
mirlsnentiffmdkenvpiascqsgdtvifetkdcfsdqitneeqaltsidfnrvnpat
gplyvegarrgdmleieildikvgkqgvmtaapglgalgeslnspttklfpiegddvvys
tglrlplqpmigvigtappgepinngtpgphggnldtkdikpgttvylpvevdgallalg
dlhaamgdgeilicgveiagtvtlkvnvkkermfplpalktdthfmtiasaetldaaavq
atknmatflanrtalsieeagmllsgagdlyvsqivnplktarfslalhyfeklgv

SCOPe Domain Coordinates for d2ii1b_:

Click to download the PDB-style file with coordinates for d2ii1b_.
(The format of our PDB-style files is described here.)

Timeline for d2ii1b_: