![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.23: CUB-like [49853] (3 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.23.3: Acetamidase/Formamidase-like [141130] (2 families) ![]() decorated fold with additional structures; contains extra C-terminal alpha+beta subdomain: beta(2)-alpha(2)-beta(2): antiparallel beta-sheet, order 1243 |
![]() | Family b.23.3.0: automated matches [191463] (1 protein) not a true family |
![]() | Protein automated matches [190714] (2 species) not a true protein |
![]() | Species Bacillus halodurans [TaxId:86665] [187863] (1 PDB entry) |
![]() | Domain d2ii1a1: 2ii1 A:1-296 [165550] Other proteins in same PDB: d2ii1a2 automated match to d2f4la1 complexed with ca |
PDB Entry: 2ii1 (more details), 1.95 Å
SCOPe Domain Sequences for d2ii1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ii1a1 b.23.3.0 (A:1-296) automated matches {Bacillus halodurans [TaxId: 86665]} mirlsnentiffmdkenvpiascqsgdtvifetkdcfsdqitneeqaltsidfnrvnpat gplyvegarrgdmleieildikvgkqgvmtaapglgalgeslnspttklfpiegddvvys tglrlplqpmigvigtappgepinngtpgphggnldtkdikpgttvylpvevdgallalg dlhaamgdgeilicgveiagtvtlkvnvkkermfplpalktdthfmtiasaetldaaavq atknmatflanrtalsieeagmllsgagdlyvsqivnplktarfslalhyfeklgv
Timeline for d2ii1a1: