Lineage for d1jafb_ (1jaf B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) Superfamily a.24.3: Cytochromes [47175] (2 families) 
Family a.24.3.2: Cytochrome c' [47179] (1 protein) Protein Cytochrome c' [47180] (7 species) 
Species Rhodocyclus gelatinosus [TaxId:28068] [47185] (1 PDB entry) 
Domain d1jafb_: 1jaf B: [16555]
Details for d1jafb_
PDB Entry: 1jaf (more details), 2.5 Å
PDB Description: crystal structure of cytochrome c' from rhodocyclus gelatinosus at 2.5 angstoms resolution
SCOP Domain Sequences for d1jafb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jafb_ a.24.3.2 (B:) Cytochrome c' {Rhodocyclus gelatinosus}
qfqkpgdaieyrqsaftlianhfgrvaamaqgkapfdakvaaenialvstlsklpltafg
pgtdkghgteakpavwsdaagfkaaadkfaaavdkldaagktgdfaqikaavgetggack
gchdkfke
SCOP Domain Coordinates for d1jafb_:
Click to download the PDB-style file with coordinates for d1jafb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jafb_:
- d1jafb_ appears in SCOP 1.57
- d1jafb_ appears in the current release, SCOPe 2.08
View in 3D
