Lineage for d1jafb_ (1jaf B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699789Protein Cytochrome c' [47180] (9 species)
  7. 2699828Species Rhodocyclus gelatinosus [TaxId:28068] [47185] (1 PDB entry)
  8. 2699830Domain d1jafb_: 1jaf B: [16555]
    complexed with hem

Details for d1jafb_

PDB Entry: 1jaf (more details), 2.5 Å

PDB Description: crystal structure of cytochrome c' from rhodocyclus gelatinosus at 2.5 angstoms resolution
PDB Compounds: (B:) cytochrome c'

SCOPe Domain Sequences for d1jafb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jafb_ a.24.3.2 (B:) Cytochrome c' {Rhodocyclus gelatinosus [TaxId: 28068]}
qfqkpgdaieyrqsaftlianhfgrvaamaqgkapfdakvaaenialvstlsklpltafg
pgtdkghgteakpavwsdaagfkaaadkfaaavdkldaagktgdfaqikaavgetggack
gchdkfke

SCOPe Domain Coordinates for d1jafb_:

Click to download the PDB-style file with coordinates for d1jafb_.
(The format of our PDB-style files is described here.)

Timeline for d1jafb_: