Lineage for d2ihr11 (2ihr 1:9-351)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3020224Fold e.38: Release factor [75619] (1 superfamily)
    4 domains: (1) 3-helical bundle; (2) alpha+beta of ferredoxin-like fold (3 and 4) alpha+beta of dsRDB-like fold
  4. 3020225Superfamily e.38.1: Release factor [75620] (2 families) (S)
  5. 3020238Family e.38.1.0: automated matches [191461] (1 protein)
    not a true family
  6. 3020239Protein automated matches [190712] (3 species)
    not a true protein
  7. 3020245Species Thermus thermophilus [TaxId:274] [187861] (3 PDB entries)
  8. 3020246Domain d2ihr11: 2ihr 1:9-351 [165549]
    Other proteins in same PDB: d2ihr12
    automated match to d1gqea_

Details for d2ihr11

PDB Entry: 2ihr (more details), 2.5 Å

PDB Description: RF2 of Thermus thermophilus
PDB Compounds: (1:) Peptide chain release factor 2

SCOPe Domain Sequences for d2ihr11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihr11 e.38.1.0 (1:9-351) automated matches {Thermus thermophilus [TaxId: 274]}
ggifdipqketrlkelerrledpslwndpeaarkvsqeaarlrrtvdtfrslesdlqgll
elmeelpaeerealkpeleeaakkldelyhqtllnfphaeknailtiqpgaggteacdwa
emllrmytrfaerqgfqvevvdltpgpeagidyaqilvkgenaygllspeagvhrlvrps
pfdasgrrhtsfagvevipevdeevevvlkpeelridvmrasgpggqgvnttdsavrvvh
lptgitvtcqttrsqiknkelalkilkarlyelerkkreeelkalrgevrpiewgsqirs
yvldknyvkdhrtglmrhdpenvldgdlmdliwaglewkagrr

SCOPe Domain Coordinates for d2ihr11:

Click to download the PDB-style file with coordinates for d2ihr11.
(The format of our PDB-style files is described here.)

Timeline for d2ihr11:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ihr12