Lineage for d2ihfa_ (2ihf A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2052191Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2052192Protein automated matches [190576] (33 species)
    not a true protein
  7. 2052325Species Thermus aquaticus [TaxId:271] [187860] (3 PDB entries)
  8. 2052327Domain d2ihfa_: 2ihf A: [165548]
    automated match to d1se8a_
    mutant

Details for d2ihfa_

PDB Entry: 2ihf (more details), 1.9 Å

PDB Description: Crystal structure of deletion mutant delta 228-252 R190A of the single-stranded DNA binding protein from Thermus aquaticus
PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d2ihfa_:

Sequence, based on SEQRES records: (download)

>d2ihfa_ b.40.4.0 (A:) automated matches {Thermus aquaticus [TaxId: 271]}
marglnqvfligtltarpdmrytpgglaildlnlagqdaftdesgqerevpwyhrvrllg
rqaemwgdllekgqlifvegrleyrqwekdgekksevqvraefidplegrgretledarg
qprlrralnqvilmgnltrdpdlrytpqgtavvrlglavnerrrgqeeerthflevqawr
elaewaselakgdgllvigrlvndswtsssgerrfqtrvealrlerpledfppee

Sequence, based on observed residues (ATOM records): (download)

>d2ihfa_ b.40.4.0 (A:) automated matches {Thermus aquaticus [TaxId: 271]}
marglnqvfligtltarpdmrytpgglaildlnlagqdaftdesgqerevpwyhrvrllg
rqaemwgdllekgqlifvegrleyrqwekdgekksevqvraefidplegrgralnqvilm
gnltrdpdlrytpqgtavvrlglavneerthflevqawrelaewaselakgdgllvigrl
vndrfqtrvealrlerpledfppee

SCOPe Domain Coordinates for d2ihfa_:

Click to download the PDB-style file with coordinates for d2ihfa_.
(The format of our PDB-style files is described here.)

Timeline for d2ihfa_: