SCOPe 2.01: Domain d2ihcd_: 2ihc D:

Lineage for d2ihcd_ (2ihc D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (10 PDB entries)

8. Domain d2ihcd_: 2ihc D: [165547]
   automated match to d1r28a_

Details for d2ihcd_

PDB Entry: 2ihc, 2.44 Å

PDB Description: Crystal structure of the bric-a-brac (BTB) domain of human BACH1

PDB Compounds: (D:) Transcription regulator protein BACH1

SCOPe Domain Sequences for d2ihcd_:

Sequence, based on SEQRES records:

>d2ihcd_ d.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrivgq
adgelnitlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfqfl
k

Sequence, based on observed residues (ATOM records):

>d2ihcd_ d.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svfayessvhstnvllslndqrkkdvlcdvtifvegqrfrahrsvlaacssyfhsrivln
itlpeevtvkgfepliqfaytaklilskenvdevckcveflsvhnieescfqflk

Timeline for d2ihcd_:

• d2ihcd_ is new in SCOPe 2.01-stable
  
• d2ihcd_ appears in SCOPe 2.02
  
• d2ihcd_ appears in the current release, SCOPe 2.08