| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
| Protein automated matches [190651] (8 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [188214] (1 PDB entry) |
| Domain d2iglc1: 2igl C:24-137 [165542] Other proteins in same PDB: d2igla2, d2iglb2, d2iglc2, d2igld2 automated match to d1tfpa_ |
PDB Entry: 2igl (more details), 1.8 Å
SCOPe Domain Sequences for d2iglc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iglc1 b.3.4.0 (C:24-137) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aqqnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtattg
dyrvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs
Timeline for d2iglc1: