Lineage for d2iglb1 (2igl B:24-137)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2769733Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2769734Protein automated matches [190651] (8 species)
    not a true protein
  7. 2769745Species Escherichia coli K-12 [TaxId:83333] [188214] (1 PDB entry)
  8. 2769747Domain d2iglb1: 2igl B:24-137 [165541]
    Other proteins in same PDB: d2igla2, d2iglb2, d2iglc2, d2igld2
    automated match to d1tfpa_

Details for d2iglb1

PDB Entry: 2igl (more details), 1.8 Å

PDB Description: Crystal Structure of E. coli YEDX, a transthyretin related protein
PDB Compounds: (B:) transthyretin-like protein

SCOPe Domain Sequences for d2iglb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iglb1 b.3.4.0 (B:24-137) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aqqnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtattg
dyrvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs

SCOPe Domain Coordinates for d2iglb1:

Click to download the PDB-style file with coordinates for d2iglb1.
(The format of our PDB-style files is described here.)

Timeline for d2iglb1: